PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_23242g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 285aa    MW: 32125.2 Da    PI: 8.4765
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_23242g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.63e-131461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT  Ed +l ++++++G g W+  +r+ g+ R++ +c++rw +yl
    MA_23242g0010 14 RGAWTVKEDMILSQYIRLHGDGGWRNLPRKAGLSRCGTSCRLRWTNYL 61
                     89********************************************97 PP

2Myb_DNA-binding49.59.5e-1667110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ +++E++l+v+ +++lG++ W++Ia +++ gRt++++k++w++
    MA_23242g0010  67 RGNISPDEEDLIVRMHRLLGNR-WSLIAGRLP-GRTDNEIKNYWNT 110
                      7899******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.1E-20564IPR009057Homeodomain-like
PROSITE profilePS5129413.939961IPR017930Myb domain
SuperFamilySSF466893.05E-2711108IPR009057Homeodomain-like
SMARTSM007171.5E-101363IPR001005SANT/Myb domain
PfamPF002491.7E-111461IPR001005SANT/Myb domain
CDDcd001676.71E-81661No hitNo description
PROSITE profilePS5129425.36262116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.9E-2465116IPR009057Homeodomain-like
SMARTSM007174.3E-1566114IPR001005SANT/Myb domain
PfamPF002495.6E-1467110IPR001005SANT/Myb domain
CDDcd001672.47E-1171112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MGRSPCSSKQ GLNRGAWTVK EDMILSQYIR LHGDGGWRNL PRKAGLSRCG TSCRLRWTNY  60
LRPDIKRGNI SPDEEDLIVR MHRLLGNRWS LIAGRLPGRT DNEIKNYWNT RLNKKLLSVN  120
NSHPKPSVQN LKTSSKSPSP LHNHVLKTTP IKTTVVIYPQ MVRPNRCNGY GGRNCSSDEA  180
LKLCNVNENT NSIVHDDSQH IAFGMANINL LEIEGGNCTS SLWSLEEQRS PHSYYFAEDT  240
ATLADSFLEL NELSSPDTNL LSLNFELEEF YREPATLVSG TIDPV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C7e-231211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1091360.0BT109136.1 Picea glauca clone GQ03205_A18 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004287618.12e-70PREDICTED: myb-related protein Hv1
RefseqXP_013458423.12e-70myb transcription factor
SwissprotQ9S9K92e-62MYB3_ARATH; Transcription factor MYB3
TrEMBLB8LMJ61e-113B8LMJ6_PICSI; Putative uncharacterized protein
STRINGGLYMA13G16890.12e-68(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22640.11e-63myb domain protein 3